ATP6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8193
Zusätzliche Namen:: MT-ATP6, MTATP6, ATPASE6
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 20kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLMNISPPTATITFIILLLLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot:: P00848
Synonyme:: ATP synthase F0 subunit 6;ATPase6;F-ATPase protein 6;MTATP6
Weitere Details:: Predicted to contribute to proton-transporting ATP synthase activity, rotational mechanism. Predicted to be involved in mitochondrial ATP synthesis coupled proton transport. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; heart; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; NARP syndrome; Parkinson's disease; multiple sclerosis; and systemic lupus erythematosus. Orthologous to human MT-ATP6 (mitochondrially encoded ATP synthase membrane subunit 6).