STK38 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8191
Zusätzliche Namen:: NDR|NDR1|STK38
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 54kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Uniprot:: Q15208
Synonyme:: NDR;Ndr Ser/Thr kinase-like protein;NDR1;NDR1 protein kinase;nuclear Dbf2-related kinase 1;serine/threonine-protein kinase 38
Weitere Details:: This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cycle and apoptosis. This protein has also been found to regulate the protein stability and transcriptional activity of the MYC oncogene. Alternative splicing results in multiple transcript variants.