IFI44 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8188
Zusätzliche Namen:: A430056A10Rik|IFI44|MTAP44|p44
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGPIGAGKSSFFNSVRSVFQGHVTHQALVGTNTTGISEKYRTYSIRDGKDGKYLPFILCDSLGLSEKEGGLCRDDIFYILNGNIRDRYQFNPMESIKLNHHDYIDSPS
Uniprot:: Q8TCB0
Synonyme:: A430056A10Rik;AW261460;interferon-induced protein 44;interferon-induced, hepatitis C-associated microtubular aggregate protein (44kD);microtubule-associated protein 44;MTAP;MTAP44;p4;p44;TBC/LysM-associated domain containing 5;TLDC5
Weitere Details:: Acts upstream of or within response to bacterium. Predicted to be located in cytoplasm. Is expressed in central nervous system and retina. Orthologous to human IFI44 (interferon induced protein 44).