ILF3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A8186
Zusätzliche Namen:: CBTF|DRBF|DRBP76|ILF3|MMP4|MPHOSPH4|MPP4|MPP4110|NF-AT-90|NF110|NF110b|NF90|NF90a|NF90b|NF90c|NF90ctv|NFAR|NFAR-1|NFAR-2|NFAR110|NFAR2|NFAR90|TCP110|TCP80
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 90kDa/100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAK
Uniprot:: Q12906
Synonyme:: CBTF;Double-stranded RNA-binding protein 76;double-stranded RNA-binding protein, 76 kD;DRBF;DRBP76;dsRNA binding protein NFAR-2/MPP4;interleukin enhancer binding factor 3, 90kD;interleukin enhancer binding factor 3, 90kDa;interleukin enhancer-binding factor 3;M phase phosphoprotein 4, nuclear factor associated with DS RNA;M-phase phosphoprotein 4;MMP4;MPHOSPH4;MPP4;MPP4110;NF-AT-90;NF110;NF110b;NF90;NF90a;NF90b;NF90c;NF90ctv;NFAR;NFAR-1;NFAR-2;NFAR110;NFAR2;NFAR90;nuclear factor associated with dsRNA;nuclear factor of activated T-cells 110 kDa;nuclear factor of activated T-cells 90 kDa;nuclear factor of activated T-cells, 90 kD;TCP110;TCP80;translational control protein 80
Weitere Details:: This gene encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein (NF90, ILF3) forms a heterodimer with a 45 kDa transcription factor (NF45, ILF2) required for T-cell expression of interleukin 2. This complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. In contrast, an isoform (NF110) of this gene that is predominantly restricted to the nucleus has only minor effects on cell growth when its levels are reduced. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Versandbedingungen:: Blue Ice