POP7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8183
Zusätzliche Namen:: 0610037N12Rik|POP7|RPP2|RPP20
Anwendung:: ELISA, WB
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
Uniprot:: O75817
Synonyme:: 0610037N12Rik;hPOP7;POP7 (processing of precursor, S. cerevisiae) homolog;processing of precursor 7, ribonuclease P subunit;processing of precursor 7, ribonuclease P/MRP subunit;ribonuclease P protein subunit p20;ribonucleases P/MRP protein subunit POP7 homolog;RNaseP protein p20;RPP2;RPP20
Weitere Details:: Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5'-leader removal. Located in nucleolus. Part of multimeric ribonuclease P complex and ribonuclease MRP complex.