P2RY14 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8178
Zusätzliche Namen:: BPR105|GPR105|P2RY14|P2Y14
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
Uniprot:: Q15391
Synonyme:: BPR105;G protein coupled receptor for UDP-glucose;G-protein coupled receptor 105;GPR105;P2Y purinoceptor 14;P2Y(14) receptor;P2Y14;P2Y14 receptor;purinergic receptor P2Y, G-protein coupled, 14;UDP-glucose receptor
Weitere Details:: The product of this gene belongs to the family of G-protein coupled receptors, which contains several receptor subtypes with different pharmacological selectivity for various adenosine and uridine nucleotides. This receptor is a P2Y purinergic receptor for UDP-glucose and other UDP-sugars coupled to G-proteins. It has been implicated in extending the known immune system functions of P2Y receptors by participating in the regulation of the stem cell compartment, and it may also play a role in neuroimmune function. Two transcript variants encoding the same protein have been identified for this gene.