KDM6A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8159
Zusätzliche Namen:: KDM6A|Utx
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 180kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPSVSQPGVHTACPRQTLANGPFSAGHVPCSTSRTLGSTDTVLIGNNHVTGSGSNGNVPYLQRNAPTLPHNRTNLTSSTEEPWKNQLSNSTQGLHKGPSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLS
Synonyme:: [histone H3]-trimethyl-L-lysine(27) demethylase 6A;bA386N14.2;bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX));histone demethylase UTX;KABUK2;lysine (K)-specific demethylase 6A;lysine-specific demethylase 6A;ubiquitously transcribed tetratricopeptide repeat gene, X chromosome;ubiquitously transcribed tetratricopeptide repeat protein X-linked;ubiquitously transcribed TPR protein on the X chromosome;ubiquitously transcribed X chromosome tetratricopeptide repeat protein;ubiquitously-transcribed TPR gene on the X chromosome;UTX
Weitere Details:: Enables DNA binding activity; histone H3-tri/di-methyl-lysine-27 demethylase activity; and identical protein binding activity. Involved in chromatin remodeling. Acts upstream of or within several processes, including chordate embryonic development; embryonic morphogenesis; and histone H3-K27 demethylation. Located in nucleus. Part of histone methyltransferase complex. Is expressed in several structures, including early conceptus; gonad; liver; lung; and spleen. Used to study chronic myelomonocytic leukemia. Human ortholog(s) of this gene implicated in several diseases, including Kabuki syndrome; bladder urothelial carcinoma; gastrointestinal system cancer (multiple); lung carcinoma (multiple); and triple-receptor negative breast cancer. Orthologous to human KDM6A (lysine demethylase 6A).

Versandbedingungen:: Blue Ice