USF2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8158
Zusätzliche Namen:: bHLHb12|FIP|USF2
Anwendung:: ELISA, WB
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMM
Uniprot:: Q15853
Synonyme:: bHLHb12;c-fos interacting protein;class B basic helix-loop-helix protein 12;FIP;FOS-interacting protein;major late transcription factor 2;upstream stimulatory factor 2;Upstream transcription factor 2
Weitere Details:: This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multiple cellular processes.