STXBP3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8153
Zusätzliche Namen:: MUNC18-3|MUNC18C|PSP|STXBP3|UNC-18C
Anwendung:: ELISA, WB
Molekulargewicht:: 68kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHDNCDKIRAILLYIFSINGTTEENLDRLIQNVKIENESDMIRNWSYLGVPIVPQSQQGKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYCSQCPAVWNGSGAVSARQKPRANYLEDRKNGSKLIVFVIGGITYSEVRCAYEVSQAHKSCEVIIGSTHVLTPKKLLDDIKMLNKPKDKVSLIKDE
Uniprot:: O00186
Synonyme:: MUNC18-3;MUNC18C;platelet Sec1 protein;protein unc-18 homolog 3;protein unc-18 homolog C;PSP;syntaxin 4 binding protein;syntaxin-binding protein 3;UNC-18C;unc18-3
Weitere Details:: Enables syntaxin binding activity. Involved in negative regulation of calcium ion-dependent exocytosis; neutrophil degranulation; and platelet aggregation. Located in cytosol; plasma membrane; and secretory granule. Is active in presynapse.