TROP-2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8129
Zusätzliche Namen:: EGP-1|EGP1|GA733-1|GA7331|GP50|M1S1|TROP-2|TROP2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 37-50 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSM
Uniprot:: P09758
Synonyme:: 40kD glycoprotein, identified by monoclonal antibody GA733;cell surface glycoprotein Trop-2;cell surface glycoprotein TROP2;EGP-1;EGP1;epithelial glycoprotein-1;GA733-1;GA7331;gastrointestinal tumor-associated antigen GA7331;GP50;M1S1;Membrane component chromosome 1 surface marker 1;membrane component, chromosome 1, surface marker 1;pancreatic carcinoma marker protein GA733-1;pancreatic carcinoma marker protein GA7331;TROP2;trophoblast cell surface antigen 2;truncated TACSTD2;tumor-associated calcium signal transducer 2
Weitere Details:: This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.

Versandbedingungen:: Blue Ice