A8123
HOXB5 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A8123
- Zusätzliche Namen:
- HHO.C10|HOX2|Hox2.1|HOX2A|HOXB5|HU-1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 29kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAFQP
- Uniprot:
- P09067
- Synonyme:
- HHO.C10;homeo box 2A;homeo box B5;homeobox protein HHO.C10;homeobox protein Hox-2A;homeobox protein Hox-B5;homeobox protein Hu-1;HOX2;Hox2.1;HOX2A;HU-1
- Weitere Details:
- This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.
- Versandbedingungen:
- Blue Ice





