ATP5O Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8103
Zusätzliche Namen:: ATP5O|ATPO|HMC08D05|OSCP
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 23kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Uniprot:: P48047
Synonyme:: ATP synthase subunit O, mitochondrial;ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit;ATP5O;ATPO;HMC08D05;human ATP synthase OSCP subunit;Oligomycin sensitivity conferral protein;oligomycin sensitivity conferral protein oscp-like protein;oligomycin sensitivity conferring protein;OSCP
Weitere Details:: The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance.