A8073
ADAMTSL1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A8073
- Zusätzliche Namen:
- ADAMTSL-1|ADAMTSL1|ADAMTSR1|C9orf94|PUNCTIN
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SLVIQDYWWSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQLCVEWAFSSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPEHLCSWGPRPANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTCGKA
- Uniprot:
- Q8N6G6
- Synonyme:
- ADAM-TS related protein 1;ADAMTS-like protein 1;ADAMTSL-1;ADAMTSR1;C9orf94;PUNCTIN;punctin-1
- Weitere Details:
- This gene encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins.
- Versandbedingungen:
- Blue Ice