EVA1A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8070
Zusätzliche Namen:: EVA1A|FAM176A|TMEM166
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DTVSDLSVRRHRRFERTLNKNVFTSAEELERAQRLEERERIIREIWMNGQPEVPGTRSLNRYY
Uniprot:: Q9H8M9
Synonyme:: FAM176A;family with sequence similarity 176, member A;protein eva-1 homolog A;protein FAM176A;TMEM166;transmembrane protein 166
Weitere Details:: Predicted to be involved in apoptotic process and autophagy. Located in intracellular membrane-bounded organelle and plasma membrane.