PHF19 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8065
Zusätzliche Namen:: MTF2L1|PCL3|PHF19|TDRD19B
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 66kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL
Uniprot:: Q5T6S3
Synonyme:: MTF2L1;PCL3;PHD finger protein 19;polycomb like 3;polycomb-like protein 3;TDRD19B;tudor domain containing 19B
Weitere Details:: Enables methylated histone binding activity. Involved in positive regulation of histone H3-K27 methylation. Colocalizes with ESC/E(Z) complex.