A8047
CEBPE Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A8047
- Zusätzliche Namen:
- c/EBP epsilon|C/EBP-epsilon|CEBPE|CRP1|IMD108|SGD1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 35kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPA
- Uniprot:
- Q15744
- Synonyme:
- c/EBP epsilon;C/EBP-epsilon;CCAAT/enhancer binding protein (C/EBP), epsilon;CCAAT/enhancer-binding protein epsilon;CRP1
- Weitere Details:
- The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined.
- Versandbedingungen:
- Blue Ice