A8014
NDUFV1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A8014
- Zusätzliche Namen:
- CI-51K|CI51KD|MC1DN4|NDUFV1|UQOR1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 51kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE
- Uniprot:
- P49821
- Synonyme:
- CI-51K;CI51KD;complex I 51 kda subunit;complex I 51kDa subunit;Complex I-51kD;complex I, mitochondrial respiratory chain;MC1DN4;mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1;mitochondrial NADH:ubiquinone oxidoreductase 51 kda subunit;NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa;NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial;NADH dehydrogenase flavoprotein 1;NADH-ubiquinone oxidoreductase 51 kDa subunit;UQOR1
- Weitere Details:
- The mitochondrial respiratory chain provides energy to cells via oxidative phosphorylation and consists of four membrane-bound electron-transporting protein complexes (I-IV) and an ATP synthase (complex V). This gene encodes a 51 kDa subunit of the NADH:ubiquinone oxidoreductase complex I; a large complex with at least 45 nuclear and mitochondrial encoded subunits that liberates electrons from NADH and channels them to ubiquinone. This subunit carries the NADH-binding site as well as flavin mononucleotide (FMN)- and Fe-S-biding sites. Defects in complex I are a common cause of mitochondrial dysfunction; a syndrome that occurs in approximately 1 in 10,000 live births. Mitochondrial complex I deficiency is linked to myopathies, encephalomyopathies, and neurodegenerative disorders such as Parkinson's disease and Leigh syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Versandbedingungen:
- Blue Ice








