A8003
SOCS4 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A8003
- Zusätzliche Namen:
- SOCS4|SOCS7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 51kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKEYHYKSKVRVLRIDAPEQQC
- Uniprot:
- Q8WXH5
- Synonyme:
- SH2 domain containing SOCS box protein;SOCS-4;SOCS-7;SOCS7;suppressor of cytokine signaling 4;suppressor of cytokine signaling 7
- Weitere Details:
- The protein encoded by this gene contains a SH2 domain and a SOCS BOX domain. The protein thus belongs to the suppressor of cytokine signaling (SOCS), also known as STAT-induced STAT inhibitor (SSI), protein family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice