A7997
OPA3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7997
- Zusätzliche Namen:
- MGA3|OPA3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK
- Uniprot:
- Q9H6K4
- Synonyme:
- 3-methylglutaconic aciduria type III;MGA3;OPA3 outer mitochondrial membrane lipid metabolism regulator;optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia);Optic atrophy 3 (Iraqi-Jewish 'optic atrophy plus');optic atrophy 3 protein
- Weitere Details:
- The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice