ATG9A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7994
Zusätzliche Namen:: APG9L1|ATG9A|mATG9|MGD3208
Anwendung:: ELISA, WB
Molekulargewicht:: 100 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRI
Uniprot:: Q7Z3C6
Synonyme:: APG9 autophagy 9-like 1;APG9-like 1;APG9L1;ATG9 autophagy related 9 homolog A;autophagy 9-like 1 protein;autophagy-related protein 9A;mATG9;MGD3208
Weitere Details:: Acts upstream of or within autophagosome assembly. Located in endosome; phagophore assembly site; and trans-Golgi network.