FTSJ1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7967
Zusätzliche Namen:: CDLIV|FTSJ1|JM23|MRX44|MRX9|SPB1|TRMT7|XLID9
Anwendung:: ELISA, WB
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
Uniprot:: Q9UET6
Synonyme:: 2'-O-ribose RNA methyltransferase TRM7 homolog;CDLIV;cell division protein;FtsJ RNA methyltransferase homolog 1;FtsJ-like protein 1;JM23;MRX44;MRX9;Protein ftsJ homolog 1;putative ribosomal RNA methyltransferase 1;putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase;rRNA (uridine-2'-O-)-methyltransferase;SPB1;TRMT7;tRNA methyltransferase 7 homolog;XLID9
Weitere Details:: This gene encodes a member of the methyltransferase superfamily. The encoded protein localizes to the nucleolus, binds to S-adenosylmethionine, and may be involved in the processing and modification of ribosomal RNA. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants.