A7965
ACSL6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7965
- Zusätzliche Namen:
- ACS2|ACSL6|FACL6|LACS 6|LACS2|LACS5
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 77 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- YGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM
- Uniprot:
- Q9UKU0
- Synonyme:
- ACS2;arachidonate--CoA ligase;FACL6;fatty-acid-Coenzyme A ligase, long-chain 6;LACS 6;LACS2;LACS5;long fatty acyl-CoA synthetase 2;Long-chain acyl-CoA synthetase 6;long-chain-fatty-acid--CoA ligase 6
- Weitere Details:
- The protein encoded by this gene catalyzes the formation of acyl-CoA from fatty acids, ATP, and CoA, using magnesium as a cofactor. The encoded protein plays a major role in fatty acid metabolism in the brain. Translocations with the ETV6 gene are causes of myelodysplastic syndrome with basophilia, acute myelogenous leukemia with eosinophilia, and acute eosinophilic leukemia. Several transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice