A7947
ST3GAL5 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7947
- Zusätzliche Namen:
- SATI|SIAT9|SIATGM3S|SPDRS|ST3Gal V|ST3GAL5|ST3GalV
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 48kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
- Uniprot:
- Q9UNP4
- Synonyme:
- alpha 2,3-sialyltransferase V;CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase;ganglioside GM3 synthase;GM3 synthase;lactosylceramide alpha-2,3-sialyltransferase;SATI;Sialyltransferase 9;sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase);SIAT9;SIATGM3S;SPDRS;ST3 beta-galactoside alpha-23-sialyltransferase 5;ST3Gal V;ST3GalV
- Weitere Details:
- Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice