ADAM12 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7940
Zusätzliche Namen:: ADAM12|ADAM12-OT1|CAR10|MCMP|MCMPMltna|MLTN|MLTNA
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ASRPVIGTNAVSIETNIPLQQGGRILCRGTHVYLGDDMPDPGLVLAGTKCADGKICLNRQCQNISVFGVHECAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQAEARQEAAESNRERGQGQEPVGSQEHASTASLTLI
Uniprot:: O43184
Synonyme:: ADAM12-OT1;CAR10;disintegrin and metalloproteinase domain-containing protein 12;MCMP;MCMPMltna;meltrin-alpha;metalloprotease-disintegrin 12 transmembrane;MLTN;MLTNA
Weitere Details:: This gene encodes a member of a family of proteins that are structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. Expression of this gene has been used as a maternal serum marker for pre-natal development. Alternative splicing results in multiple transcript variants encoding different isoforms. Shorter isoforms are secreted, while longer isoforms are membrane-bound form.