A7937
Troponin I2 (TNNI2) Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7937
- Zusätzliche Namen:
- AMCD2B|DA2B|DA2B1|FSSV|fsTnI|Troponin I2 (TNNI2)
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 21kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
- Uniprot:
- P48788
- Synonyme:
- AMCD2B;DA2B;DA2B1;FSSV;fsTnI;troponin I fast twitch 2;troponin I type 2 (skeletal, fast);troponin I, fast skeletal muscle;Troponin I, fast-twitch isoform;troponin I, skeletal, fast
- Weitere Details:
- This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice