A7920
OCT4 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7920
- Zusätzliche Namen:
- Oct-3|Oct-4|OCT3|Oct3/4|OCT4|OTF-3|OTF3|OTF4
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- ABP:
- No Import Docs
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPV
- Uniprot:
- Q01860
- Synonyme:
- Oct-3;Oct-4;OCT3;OCT4;octamer-binding protein 3;octamer-binding protein 4;octamer-binding transcription factor 3;OTF-3;OTF3;OTF4;POU domain transcription factor OCT4;POU domain, class 5, transcription factor 1;POU-type homeodomain-containing DNA-binding protein
- Weitere Details:
- This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12.
- Versandbedingungen:
- Blue Ice



