A7894
FCGR3B Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7894
- Zusätzliche Namen:
- CD16|CD16-I|CD16A|CD16b|FCG3|FCGR3|FCGR3A|FCGR3B|FCR-10|FCRIII|FCRIIIb
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 26kDa/46kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
- Uniprot:
- O75015
- Synonyme:
- CD16;CD16A;CD16b;Fc fragment of IgG, low affinity IIIb, receptor (CD16b);Fc gamma receptor III-B;Fc gamma receptor IIIb;Fc-gamma receptor IIIb (CD 16);fc-gamma RIII-beta;fc-gamma RIIIb;FCG3;FCGR3;FCGR3A;FCR-10;FCRIII;FCRIIIb;igG Fc receptor III-1;low affinity immunoglobulin gamma Fc region receptor III-B
- Weitere Details:
- The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the peripheral circulation. Several transcript variants encoding different isoforms have been found for this gene. A highly-similar gene encoding a related protein is also found on chromosome 1.
- Versandbedingungen:
- Blue Ice

