A7860
Proprotein Convertase 9(PCSK9) Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7860
- Zusätzliche Namen:
- FH3|FHCL3|HCHOLA3|LDLCQ1|NARC-1|NARC1|PC9|Proprotein Convertase 9(PCSK9)
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molekulargewicht:
- 80 kDa/65 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
- Uniprot:
- Q8NBP7
- Synonyme:
- convertase subtilisin/kexin type 9 preproprotein;FH3;FHCL3;HCHOLA3;LDLCQ1;NARC-1;NARC1;neural apoptosis regulated convertase 1;Neural apoptosis-regulated convertase 1;PC9;Proprotein convertase 9;proprotein convertase subtilisin/kexin type 9;subtilisin/kexin-like protease PC9
- Weitere Details:
- This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Mutations in this gene have been associated with autosomal dominant familial hypercholesterolemia. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice








