CALHM1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7858
Zusätzliche Namen:: CALHM1|FAM26C
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 45kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VRSVRPCFTQAAFLKSKYWSHYIDIERKLFDETCTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV
Uniprot:: Q8IU99
Synonyme:: calcium homeostasis modulator protein 1;FAM26C;family with sequence similarity 26, member C;Protein FAM26C
Weitere Details:: This gene encodes a calcium channel that plays a role in processing of amyloid-beta precursor protein. A polymorphism at this locus has been reported to be associated with susceptibility to late-onset Alzheimer's disease in some populations, but the pathogenicity of this polymorphism is unclear.