SPICE1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7855
Zusätzliche Namen:: CCDC52|SPICE|SPICE1
Anwendung:: ELISA, WB
Molekulargewicht:: 120kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSFVRVNRCGPRVGVRKTPKVKKKKTSVKQEWDNTVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPETLNLEKRRLSIMKEILSDQYQMQDVLEKSDHLIAAAKELFPRRRTGFPNVTVAPDSSQGPIVVNQDPITQSIFNESVIEPQALNDVDGEEEGTVNSQSGESENENELDNSLNSQSNTNTDRFLQQLTEENFELISKL
Uniprot:: Q8N0Z3
Synonyme:: CCDC52;coiled-coil domain-containing protein 52;SPICE;Spindle and centriole-associated protein;spindle and centriole-associated protein 1
Weitere Details:: Involved in metaphase plate congression; mitotic spindle assembly; and regulation of centriole replication. Located in centriole; centrosome; and spindle.