A7843
ALG2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7843
- Zusätzliche Namen:
- ALG2|CDG1I|CDGIi|CMS14|CMSTA3|hALPG2|NET38
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 47kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV
- Uniprot:
- Q9H553
- Synonyme:
- alpha-1,3-mannosyltransferase ALG2;alpha-1,3/1,6-mannosyltransferase ALG2;asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase);asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase);asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog;asparagine-linked glycosylation protein 2 homolog;CDG1I;CDGIi;CMS14;CMSTA3;GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase;GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase;GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase;hALPG2;homolog of yeast ALG2;NET38
- Weitere Details:
- This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

