A7832
REEP1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7832
- Zusätzliche Namen:
- C2orf23|DSMA6|HMN5B|REEP1|SPG31|Yip2a
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 22kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA
- Uniprot:
- Q9H902
- Synonyme:
- C2orf23;HMN5B;receptor expression-enhancing protein 1;spastic paraplegia 31 protein;SPG31;Yip2a
- Weitere Details:
- This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice