RBFOX1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7811
Zusätzliche Namen:: 2BP1|A2BP1|FOX-1|FOX1|HRNBP1|RBFOX1
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 45-50 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLASQGVLLHPYGVPMIVPAAPYLPGLIQGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSENT
Uniprot:: Q9NWB1
Synonyme:: 2BP1;A2BP1;ataxin 2-binding protein 1;Ataxin-2-binding protein 1;FOX-1;fox-1 homolog A;fox-1-like RNA-binding protein 1;FOX1;hexaribonucleotide-binding protein 1;HRNBP1;RNA binding protein fox-1 homolog 1;RNA binding protein, fox-1 homolog 1
Weitere Details:: The Fox-1 family of RNA-binding proteins is evolutionarily conserved, and regulates tissue-specific alternative splicing in metazoa. Fox-1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. Fox-1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice