RASGRP3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7791
Zusätzliche Namen:: GRP3|RASGRP3
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 78kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG
Uniprot:: Q8IV61
Synonyme:: calcium and DAG-regulated guanine nucleotide exchange factor III;calcium- and diacylglycerol-regulated guanine nucleotide exchange factor III;CalDAG-GEFIII;GRP3;guanine nucleotide exchange factor for Rap1;RAS guanyl releasing protein 3 (calcium and DAG-regulated);ras guanyl-releasing protein 3
Weitere Details:: The protein encoded by this gene is a guanine nucleotide exchange factor that activates the oncogenes HRAS and RAP1A. Defects in this gene have been associated with systemic lupus erythematosus and several cancers.