A7784
FBXW11 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7784
- Zusätzliche Namen:
- BTRC2|BTRCP2|Fbw11|FBW1B|FBXW11|FBXW1B|Hos|NEDJED
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 62kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
- Uniprot:
- Q9UKB1
- Synonyme:
- beta-transducin repeat-containing protein 2;BTRC2;BTRCP2;F-box and WD repeats protein beta-TrCP2;F-box and WD-40 domain protein 11;F-box and WD-40 domain protein 1B;F-box protein Fbw1b;F-box/WD repeat-containing protein 11;F-box/WD repeat-containing protein 1B;Fbw11;FBW1B;FBXW1B;homologous to Slimb protein;Hos;NEDJED
- Weitere Details:
- This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons.
- Versandbedingungen:
- Blue Ice








