A7776
STARD3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7776
- Zusätzliche Namen:
- CAB1|es64|MLN64|STARD3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA
- Uniprot:
- Q14849
- Synonyme:
- CAB1;es64;metastatic lymph node gene 64 protein;metastatic lymph node protein 64;MLN 64;MLN64;Protein CAB1;StAR-related lipid transfer (START) domain containing 3;stAR-related lipid transfer protein 3;START domain-containing protein 3;steroidogenic acute regulatory protein related
- Weitere Details:
- This gene encodes a member of a subfamily of lipid trafficking proteins that are characterized by a C-terminal steroidogenic acute regulatory domain and an N-terminal metastatic lymph node 64 domain. The encoded protein localizes to the membranes of late endosomes and may be involved in exporting cholesterol. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice