A7774
CPLX2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7774
- Zusätzliche Namen:
- 921-L|CPLX2|CPX-2|CPX2|Hfb1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 15kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
- Uniprot:
- Q6PUV4
- Synonyme:
- 921-L;complexin II;complexin-2;CPX II;CPX-2;CPX2;Hfb1;synaphin 1;Synaphin-1
- Weitere Details:
- Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice

