A7772
[KO Validated] KDM5B Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A7772
- Zusätzliche Namen:
- 5B|CT31|JARID1B|MRT65|PLU-1|PLU1|PPP1R98|PUT1|RBBP2H1A|RBP2-H1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 176kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEE
- Uniprot:
- Q9UGL1
- Synonyme:
- [histone H3]-trimethyl-L-lysine(4) demethylase 5B;cancer/testis antigen 31;CT31;histone demethylase JARID1B;JARID1B;jumonji, AT rich interactive domain 1B;jumonji/ARID domain-containing protein 1B;lysine (K)-specific demethylase 5B;lysine-specific demethylase 5B;MRT65;PLU-1;PLU1;PPP1R98;protein phosphatase 1, regulatory subunit 98;PUT1;putative DNA/chromatin binding motif;RBBP2H1A;RBP2-H1;retinoblastoma-binding protein 2 homolog 1;retinoblastoma-binding protein 2, homolog 1A
- Weitere Details:
- This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice
![[KO Validated] KDM5B Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7772/A7772_1.jpg)
![[KO Validated] KDM5B Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7772/A7772_2.jpg)
![[KO Validated] KDM5B Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7772/A7772_Q1309_KO-WB_01.jpg)
![[KO Validated] KDM5B Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7772/A7772_Q1309_IF_01.jpg)