A7768
COQ7 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7768
- Zusätzliche Namen:
- CAT5|CLK-1|CLK1|COQ10D8|COQ7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 22kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
- Uniprot:
- Q99807
- Synonyme:
- 5-demethoxyubiquinone hydroxylase, mitochondrial;CAT5;CLK-1;CLK1;coenzyme Q biosynthesis protein 7 homolog;coenzyme Q7 homolog, ubiquinone;COQ10D8;COQ7 coenzyme Q, 7 homolog ubiquinone;DMQ hydroxylase;placental protein KG-20;timing protein clk-1 homolog;ubiquinone biosynthesis monooxygenase COQ7;ubiquinone biosynthesis protein COQ7 homolog
- Weitere Details:
- The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice