A7759
NAT8 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7759
- Zusätzliche Namen:
- ATase2|CCNAT|CML1|GLA|Hcml1|NAT8|TSC501|TSC510
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLP
- Uniprot:
- Q9UHE5
- Synonyme:
- acetyltransferase 2;ATase2;camello-like protein 1;CCNAT;CML1;cysteinyl-conjugate N-acetyltransferase;GLA;Hcml1;kidney- and liver-specific gene product;N-acetyltransferase 8;N-acetyltransferase 8 (camello like);N-acetyltransferase 8 (GCN5-related, putative);probable N-acetyltransferase 8;TSC501;TSC510
- Weitere Details:
- This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene.
- Versandbedingungen:
- Blue Ice