TRPC3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7742
Zusätzliche Namen:: SCA41|TRP3|TRPC3
Anwendung:: ELISA, WB
Molekulargewicht:: 96kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARD
Uniprot:: Q13507
Synonyme:: hTrp-3;SCA41;short transient receptor potential channel 3;transient receptor potential cation channel subfamily C member 3 variant c;transient receptor protein 3;TRP3
Weitere Details:: The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol second messenger system and also by depletion of intracellular calcium stores. Two transcript variants encoding different isoforms have been found for this gene.