A7738
Contactin 2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7738
- Zusätzliche Namen:
- AXT|Contactin 2|FAME5|TAG-1|TAX|TAX1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 130kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVEN
- Uniprot:
- Q02246
- Synonyme:
- axonal glycoprotein TAG-1;Axonin-1;axonin-1 cell adhesion molecule;AXT;contactin 2 (axonal);contactin 2 (transiently expressed);contactin-2;FAME5;TAG-1;TAX;TAX1;transient axonal glycoprotein 1
- Weitere Details:
- This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy.
- Versandbedingungen:
- Blue Ice