SLC4A2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7729
Zusätzliche Namen:: AE2|BND3L|EPB3L1|HKB3|NBND3|SLC4A2
Anwendung:: ELISA, WB
Molekulargewicht:: 140kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DDGGASGRPLPKAQPGHRSYNLQERRRIGSMTGAEQALLPRVPTDEIEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKGSTQSGREGREPGPTPRARP
Uniprot:: P04920
Synonyme:: AE2;anion exchange protein 2;anion exchanger 2 type a;anion exchanger 2 type b1;anion exchanger 2 type b2;BND3L;EPB3L1;erythrocyte membrane protein band 3-like 1;HKB3;NBND3;non-erythroid band 3-like protein;solute carrier family 4 (anion exchanger), member 2;Solute carrier family 4 member 2
Weitere Details:: This gene encodes a member of the anion exchanger family of membrane transport proteins. The encoded protein regulates intracellular pH, biliary bicarbonate secretion, and chloride uptake. Reduced expression of this gene may be associated with primary biliary cirrhosis (PBC) in human patients, while differential expression of this gene may be associated with malignant hepatocellular carcinoma, colon and gastric cancers.