A7723
SCN2B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7723
- Zusätzliche Namen:
- ATFB14|SCN2B
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 24kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAV
- Uniprot:
- O60939
- Synonyme:
- ATFB14;neuronal voltage-gated sodium channel beta 2 subunit;sodium channel subunit beta-2;sodium channel, voltage gated, type II beta subunit;sodium channel, voltage-gated, type II, beta polypeptide
- Weitere Details:
- The protein encoded by this gene is the beta 2 subunit of the type II voltage-gated sodium channel. The encoded protein is involved in cell-cell adhesion and cell migration. Defects in this gene can be a cause of Brugada Syndrome, atrial fibrillation, or sudden infant death syndrome.
- Versandbedingungen:
- Blue Ice