A7719
PSEN2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7719
- Zusätzliche Namen:
- AD3L|AD4|CMD1V|PS2|PSEN2|STM2
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 21kDa/35kDa/50kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VLCPKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGD
- Uniprot:
- P49810
- Synonyme:
- AD3L;AD3LP;AD4;AD5;Alzheimer disease 4;CMD1V;E5-1;presenilin-2;PS-2;PS2;STM-2;STM2
- Weitere Details:
- Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.
- Versandbedingungen:
- Blue Ice