A7717
MAPK11 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7717
- Zusätzliche Namen:
- MAPK11|p38-2|P38B|p38Beta|P38BETA2|PRKM11|SAPK2|SAPK2B
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 41kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
- Uniprot:
- Q15759
- Synonyme:
- MAP kinase 11;MAP kinase p38 beta;mitogen-activated protein kinase 11;mitogen-activated protein kinase p38 beta;mitogen-activated protein kinase p38-2;p38-2;P38B;p38Beta;P38BETA2;PRKM11;SAPK2;SAPK2B;Stress-activated protein kinase 2b;stress-activated protein kinase-2;stress-activated protein kinase-2b
- Weitere Details:
- This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The encoded protein can be activated by proinflammatory cytokines and environmental stresses through phosphorylation by mitogen activated protein kinase kinases (MKKs). Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice








