A7712
POU4F3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7712
- Zusätzliche Namen:
- BRN3C|DFNA15|DFNA42|DFNA52|POU4F3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 37kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDV
- Uniprot:
- Q15319
- Synonyme:
- brain-3C;brain-specific homeobox/POU domain protein 3C;brn-3C;BRN3C;deafness, autosomal dominant 42;DFNA15;DFNA42;DFNA52;POU domain, class 4, transcription factor 3
- Weitere Details:
- This gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in this gene are the cause of non-syndromic sensorineural deafness autosomal dominant type 15.
- Versandbedingungen:
- Blue Ice

