PLC gamma 1 (PLCG1) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7711
Zusätzliche Namen:: NCKAP3|PLC gamma 1 (PLCG1)|PLC-II|PLC1|PLC148|PLCgamma1
Anwendung:: ELISA, WB
Molekulargewicht:: 160kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALF
Uniprot:: P19174
Synonyme:: 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate;1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1;inositoltrisphosphohydrolase;monophosphatidylinositol phosphodiesterase;NCKAP3;phosphatidylinositol phospholipase C;phosphoinositidase C;phosphoinositide phospholipase C;phosphoinositide phospholipase C-gamma-1;phospholipase C-148;Phospholipase C-gamma-1;phospholipase C-II;phospholipase C, gamma 1 (formerly subtype 148);PLC-148;PLC-gamma-1;PLC-II;PLC1;PLC148;PLCgamma1;triphosphoinositide phosphodiesterase
Weitere Details:: The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice