A7709
ACTL6A Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A7709
- Zusätzliche Namen:
- ACTL6|ACTL6A|Arp4|ARPN-BETA|BAF53A|INO80K|SMARCN1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 47kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFP
- Uniprot:
- O96019
- Synonyme:
- 53 kDa BRG1-associated factor A;actin-like protein 6A;actin-related protein 4;actin-related protein Baf53a;ACTL6;Arp4;ARPN-BETA;arpNbeta;BAF complex 53 kDa subunit;BAF53;BAF53A;BRG1-associated factor 53A;hArpN beta;INO80 complex subunit K;INO80K;SMARCN1
- Weitere Details:
- This gene encodes a family member of actin-related proteins (ARPs), which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a 53 kDa subunit protein of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. Together with beta-actin, it is required for maximal ATPase activity of BRG1, and for the association of the BAF complex with chromatin/matrix. Three transcript variants that encode two different protein isoforms have been described.
- Versandbedingungen:
- Blue Ice








