ALDH1L1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A7707
Zusätzliche Namen:: 10-fTHF|10-FTHFDH|ALDH1L1|FDH|FTHFD
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 100 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMI
Uniprot:: O75891
Synonyme:: 10-formyltetrahydrofolate dehydrogenase;10-fTHF;10-FTHFDH;Aldehyde dehydrogenase family 1 member L1;cytosolic 10-formyltetrahydrofolate dehydrogenase;FDH;FTHFD;MER57B-ALDH1L1
Weitere Details:: The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family. Loss of function or expression of this gene is associated with decreased apoptosis, increased cell motility, and cancer progression. There is an antisense transcript that overlaps on the opposite strand with this gene locus. Alternative splicing results in multiple transcript variants.